PlGF

CAT:
209-M30-019
Size:
5 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PlGF - image 1

PlGF

  • Description :

    Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. All eight cysteine residues involved in intra and interchain disulfides are conserved among these growth factors. As a result of alternative splicing, three PlGF RNAs encoding monomeric human PlGF1, PlGF2 and PlGF3 isoform precursors containing 149, 179 and 219 amino acid residues, respectively, have been described. In normal mouse tissues, only one mouse PlGF mRNA encoding the equivalent of human PlGF2 has been identified. Mouse PlGF shares 65% amino acid identity with human PlGF2. The gene for PlGF has been mapped to mouse chromosome 12 and human chromosome 14. PlGF binds with high affinity to Flt1, but not to Flk1/KDR.
  • Synonyms :

    Pgf; PlGF; Plgf; AI854365
  • NCBI Gene ID :

    18654
  • UniProt :

    P49764
  • Accession Number :

    NP_032853
  • Accession Number mRNA :

    NM_008827
  • Chromosomal Location :

    12 D; 12 39.0 cM
  • Reactivity :

    Mouse
  • Cross Reactivity :

    Mouse
  • Sequence :

    ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
  • Assay Protocol :

    Centrifuge vial prior to opening. The lyophilised PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use.
  • Purity :

    > 95% by SDS-PAGE
  • Bioactivity :

    Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5 - 10 ng/mL.
  • Length :

    135/132
  • Form :

    Lyophilized
  • Buffer :

    25 mM Tris, 75 mM NaCl pH 8.5
  • Additives :

    BSA (50-fold)
  • Reconstitution :

    50 mM acetic acid
  • Molecular Weight :

    ~40 kDa
  • Storage Conditions :

    The lyophilized mouse PIGF, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C.
  • Host or Source :

    Insect cells
  • N Terminal Sequence :

    ALSAGNNSTE and AGNNSTE

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide