PlGF

CAT:
209-M30-019S
Size:
2 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PlGF - image 1

PlGF

  • Description :

    Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. All eight cysteine residues involved in intra and interchain disulfides are conserved among these growth factors. As a result of alternative splicing, three PlGF RNAs encoding monomeric human PlGF-1, PlGF-2 and PlGF-3 isoform precursors containing 149, 179 and 219 amino acid residues, respectively, have been described. In normal mouse tissues, only one mouse PlGF mRNA encoding the equivalent of human PlGF-2 has been identified. Mouse PlGF shares 65% amino acid identity with human PlGF-2. The gene for PlGF has been mapped to mouse chromosome 12 and human chromosome 14. PlGF binds with high affinity to Flt1, but not to Flk1/KDR.
  • Synonyms :

    Pgf; PlGF; Plgf; AI854365; placental growth factor
  • NCBI Gene ID :

    18654
  • UniProt :

    P49764
  • Accession Number :

    NP_032853
  • Accession Number mRNA :

    NM_008827
  • Chromosomal Location :

    12 D; 12 39.0 cM
  • Reactivity :

    Mouse
  • Cross Reactivity :

    Mouse
  • Sequence :

    ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
  • Assay Protocol :

    Centrifuge vial prior to opening. The lyophilised PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use.
  • Purity :

    > 95% by SDS-PAGE
  • Bioactivity :

    Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5 - 10 ng/mL.
  • Length :

    135/132
  • Form :

    Lyophilized
  • Buffer :

    25 mM Tris, 75 mM NaCl pH 8.5
  • Additives :

    BSA (50-fold)
  • Reconstitution :

    50 mM acetic acid
  • Molecular Weight :

    ~40 kDa
  • Storage Conditions :

    The lyophilized mouse PIGF, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C.
  • Host or Source :

    Insect cells
  • N Terminal Sequence :

    ALSAGNNSTE and AGNNSTE

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide