PlGF

• Description :

  Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. All eight cysteine residues involved in intra and interchain disulfides are conserved among these growth factors. As a result of alternative splicing, three PlGF RNAs encoding monomeric human PlGF-1, PlGF-2 and PlGF-3 isoform precursors containing 149, 179 and 219 amino acid residues, respectively, have been described. In normal mouse tissues, only one mouse PlGF mRNA encoding the equivalent of human PlGF-2 has been identified. Mouse PlGF shares 65% amino acid identity with human PlGF-2. The gene for PlGF has been mapped to mouse chromosome 12 and human chromosome 14. PlGF binds with high affinity to Flt1, but not to Flk1/KDR.

• Synonyms :

  Pgf; PlGF; Plgf; AI854365; placental growth factor

• NCBI Gene ID :

  18654

• UniProt :

  P49764

• Accession Number :

  NP_032853

• Accession Number mRNA :

  NM_008827

• Chromosomal Location :

  12 D; 12 39.0 cM

• Reactivity :

  Mouse

• Cross Reactivity :

  Mouse

• Sequence :

  ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP

• Assay Protocol :

  Centrifuge vial prior to opening. The lyophilised PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use.

• Purity :

  > 95% by SDS-PAGE

• Bioactivity :

  Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5 - 10 ng/mL.

• Length :

  135/132

• Form :

  Lyophilized

• Buffer :

  25 mM Tris, 75 mM NaCl pH 8.5

• Additives :

  BSA (50-fold)

• Reconstitution :

  50 mM acetic acid

• Molecular Weight :

  ~40 kDa

• Storage Conditions :

  The lyophilized mouse PIGF, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C.

• Host or Source :

  Insect cells

• N Terminal Sequence :

  ALSAGNNSTE and AGNNSTE