Leptin pegylated antagonist (mutant L39A/D40A/F41A) Recombinant Protein

Leptin pegylated antagonist (mutant L39A/D40A/F41A) Recombinant Protein

• Description: Mono-pegylated (with 20 kDa PEG)recombinant ovine leptin antagonist is one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume it runs on the SDS-PAGE as 48 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. Ovine leptin was initially mutated, resulting in L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques according to Niv-Spector et al (2005) Biochemical Journal, 291, 221-230 and its pegylation was similar to that of mouse leptin antagonist is described in Elinav et al. Endocrinology (2009)150, 3083-3091.
• Synonyms: Lep; ob; obese
• CAS Number: 9000-83-3
• NCBI Gene ID: 443534
• Accession Number: XP_027824581.2
• Accession Number mRNA: XM_027968780.2
• Host: E. coli
• Origin Species: Ovine
• Species Reactivity: Ovine
• Tag: PEG
• Sequence: AVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGAAAIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG
• Detection Range: Recombinant ovine pegylated leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Its in vitro activity is 6-8 fold lower than the non-pegylated antagonist but in vivo it has profound weight gain effect (as compared to the non-pegylated antagonist like in mouse leptin antagonists), resulting mainly from increased food intake.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 95.0% as determined by Gel filtration and SDS-PAGE gel.
• Length: 146
• Form: Lyophilized
• Reconstitution: It is recommended to reconstitute the lyophilized recombinant ovine pegylated leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions.
• Molecular Weight: 35.6 kDa
• Shipping Conditions: Room Temperature