Lactogen, placental Recombinant Protein

Lactogen, placental Recombinant Protein

• Description: Recombinant human placental lactogen, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 22.4 kDa, was purified by proprietary chromatographic techniques.
• Synonyms: Chorionic somatomammotropin hormone 1, Choriomammotropin, Placental lactogen (PL)
• CAS Number: 9000-83-3
• NCBI Gene ID: 1442
• UniProt: P0DML2
• Accession Number: NP_001308.1
• Accession Number mRNA: NM_001317.6
• Host: E. coli
• Origin Species: Human
• Species Reactivity: Human
• Sequence: AVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
• Detection Range: Recombinant human PL is fully biologically active as evidenced by inducing proliferation of Nb2 cells.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
• Length: 192
• Form: Lyophilized
• Reconstitution: It is recommended to reconstitute the lyophilized hPL in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
• Molecular Weight: 22.4 kDa
• Shipping Conditions: Room Temperature