IL-22 receptor antagonist (Y51A) , pegylated Recombinant Protein

IL-22 receptor antagonist (Y51A) , pegylated Recombinant Protein

• Description: Mono-pegylated (with 20 kDa PEG)recombinant mouse interleukin 22 Y51A mutant (numbering according to human IL-22 including signal peptide) is one polypeptide chain containing 147 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 36 kDa as determined by MS. However due to enlarged hydrodymanic volume it runs on the SDS-PAGE as 50 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. For more details see L. Niv-Spector et al. Protein Eng Des Sel. (PEDS) 25:397-404 (2012).
• Synonyms: IL22; IL-22; Iltif; IL-22a; ILTIFa
• CAS Number: 9000-83-3
• NCBI Gene ID: 50929
• UniProt: Q9JJY9
• Accession Number: NP_058667.1
• Accession Number mRNA: NM_016971
• Host: E. coli
• Origin Species: Mouse
• Species Reactivity: Mouse
• Tag: PEG
• Sequence: ALPVNTRCKLEVSNFQQPAIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
• Detection Range: Recombinant murine IL-22 Y51A mutant is biologically active, capable of full inhibition of mouse IL-22 induced STAT3 phosphorylation in HepG cells. Its inhibitory acrtivity in vitro is ~ 10-20% compared to the non-pegylated mIL22 (Y51A) mutant.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
• Length: 147
• Form: Lyophilized
• Reconstitution: It is recommended to reconstitute the lyophilized pegylated mouse IL22 Y51A in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions.
• Molecular Weight: 16.7 kDa
• Shipping Conditions: Room Temperature