IL-22 receptor antagonist (R55A) Recombinant Protein
CAT:
209-500-032S
Size:
10 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

IL-22 receptor antagonist (R55A) Recombinant Protein
- Description: IL-22 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-beta/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant murine IL-22 mutant R55A (numbering according to human IL-22 including signal peptide) produced in E.Coli is a single, non-glycosylated polypeptide chain containing 147 amino acids and having a molecular mass of 16.7 kDa. Preparation of recombinant mIL-22 antagonists provides new tools for the study of IL-22 activity and of eventual therapeutic means for attenuating its negative effects. For more details see L. Niv-Spector et al. Protein Eng Des Sel. (PEDS) 25:397-404 (2012).
- Synonyms: IL22; IL-22; Iltif; IL-22a; ILTIFa
- CAS Number: 9000-83-3
- NCBI Gene ID: 50929
- UniProt: Q9JJY9
- Accession Number: NP_058667.1
- Accession Number mRNA: NM_016971
- Host: E. coli
- Origin Species: Mouse
- Species Reactivity: Mouse
- Sequence: ALPVNTRCKLEVSNFQQPYIVNAAFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
- Detection Range: Recombinant murine IL-22 R55A mutant is capable of full inhibition of STAT3 phosphorylation induced by mouse interleukin 22 in HepG cells. Its affinity toward immobilized mIL-22 receptor α1 extracellular domain (mIL-22 Rα1-ECD) or IL-22 binding protein is similar to the non mutated mouse interleukin 22. Mouse IL-22 antagonist (R55A) has extremely low agonistic activity in this bioassay.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Length: 147
- Form: Lyophilized
- Reconstitution: It is recommended to reconstitute the lyophilized IL-22 R55A in sterile H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions containing carrier protein such as BSA, HSA or similar.
- Molecular Weight: 16.7 kDa
- Shipping Conditions: Room Temperature