IGF-1 Recombinant Protein
CAT:
209-500-024S
Size:
10 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

IGF-1 Recombinant Protein
- Description: IGF-1 is a small protein secreted mainly but not solely by the liver and circulating in blood mostly as a complex with various IGF binding proteins in the blood. It has growth-regulating, insulin-like, and mitogenic activities and it is secreted in response to growth hormone stimulation. Recombinant rabbit IGF-I produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 7639 Dalton.
- Synonyms: Igf1; Igf-1; Igf-I; C730016P09Rik
- CAS Number: 9000-83-3
- NCBI Gene ID: 100008668
- UniProt: Q95222
- Accession Number: NP_001075495.1
- Accession Number mRNA: NM_001082026.1
- Host: E. coli
- Origin Species: Rabbit
- Species Reactivity: Rabbit
- Sequence: MTGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKAA
- Detection Range: rbIGF-I is biologically active when compared to human IGF-1. The ED50, calculated by the dose -dependent proliferation of human MCF/7 cells is 5 to 25 ng/ml in the cell culture mixture dependent on culture conditions. Its activity consisits of 30-40 % compared to human IGF-1.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Length: 72
- Form: Lyophilized
- Reconstitution: It is recommended to reconstitute the lyophilized rbIGF-I in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
- Molecular Weight: 7.6 kDa
- Shipping Conditions: Room Temperature