Growth Hormone

CAT:
209-500-009S
Size:
20 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Growth Hormone - image 1

Growth Hormone

  • Description:

    Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
  • Synonyms:

    Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
  • NCBI Gene ID:

    280804
  • UniProt:

    P01246
  • Accession Number:

    NP_851339.1
  • Accession Number mRNA:

    NM_180996.1
  • Reactivity:

    Bovine
  • Cross Reactivity:

    Bovine
  • Sequence:

    AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
  • Assay Protocol:

    It is recommended to reconstitute the lyophilized recombinant bovine growth hormone in 0.4% NaHCO3 or water adjusted to pH 9, not less than 100µg recombinant bovine growth hormone per ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.
  • Endotoxin:

    < 0.1 ng/µg of protein (< 1EU/µg)
  • Purity:

    > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
  • Bioactivity:

    Recombinant bovine growth hormone is fully biologically active when compared to WHO reference standard using in vitro bioassay in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. Recombinant bovine growth hormone is also capable of forming a 1:2 complex with the recombinant ovine growth hormone receptor extracellular domain (ECD) .
  • Length:

    191
  • Form:

    Lyophilized
  • Reconstitution:

    Water, pH 9
  • Molecular Weight:

    21.8 kDa
  • Host or Source:

    E. coli
  • N Terminal Sequence:

    AFPAM