Recombinant Human adenovirus F serotype 40 Hexon protein (L3), partial

CAT:
399-CSB-EP318172HIR-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human adenovirus F serotype 40 Hexon protein (L3), partial - image 1

Recombinant Human adenovirus F serotype 40 Hexon protein (L3), partial

  • Product Name Alternative:

    (CP-H) (Protein II)
  • Abbreviation:

    Recombinant Human adenovirus F serotype 40 Hexon protein, partial
  • Gene Name:

    L3
  • UniProt:

    P11819
  • Expression Region:

    601-830aa
  • Organism:

    Human adenovirus F serotype 40 (HAdV-40) (Human adenovirus 40)
  • Target Sequence:

    LEAMLRNDTNDQSFNDYLCAANMLYPIPANATSVPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFTYSGSVPYLDGTFYLNHTFKKVSVMFDSSVSWPGNDRLLTPNEFEIKRTVDGEGYNVAQCNMTKDWFLIQMLSHYNIGYQGFHVPESYKDRMYSFFRNFQPMSRQVVDTTTYTEYQNVTLPFQHNNSGFVGYMGPAIREGQAYPANYPYPLIGQTAVPSL
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Major capsid protein that self-associates to form 240 hexon trimers, each in the shape of a hexagon, building most of the pseudo T=25 capsid. Assembled into trimeric units with the help of the chaperone shutoff protein. Transported by pre-protein VI to the nucleus where it associates with other structural proteins to form an empty capsid. Might be involved, through its interaction with host dyneins, in the intracellular microtubule-dependent transport of incoming viral capsid to the nucleus.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    33.8 kDa
  • References & Citations:

    "The genes encoding the DNA binding protein and the 23K protease of adenovirus types 40 and 41." Vos H.L., der Lee F.M., Reemst A.M.C.B., van Loon A.E., Sussenbach J.S. Virology 163:1-10 (1988) .
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial