Alpha Synuclein Pre-formed Fibrils

CAT:
400-SPR-482C
Size:
2x 100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: Yes
Alpha Synuclein Pre-formed Fibrils - image 1
Alpha Synuclein Pre-formed Fibrils - image 2
Alpha Synuclein Pre-formed Fibrils - image 3
Alpha Synuclein Pre-formed Fibrils - image 4
Thumbnail 1
Thumbnail 2
Thumbnail 3
Thumbnail 4

Alpha Synuclein Pre-formed Fibrils

  • Background:

    Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6). The A53T mutation is a missense point mutation where alanine is replaced by threonine at the 53rd amino acid. This mutation has been linked to early-onset Parkinson's Disease and increased rates of alpha synuclein fibrillization.
  • Description:

    Rat Recombinant Alpha Synuclein Protein Pre-formed Fibrils
  • Product Name Alternative:

    Alpha synuclein pre-formed fibrils, Alpha Synuclein PFFs, Alpha Synuclein PFF, Alpha synuclein aggregates, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkison disease familial 1 Protein
  • UNSPSC:

    12352202
  • Gene ID:

    29219
  • Swiss Prot:

    P37377
  • Accession Number:

    NP_062042.1
  • Cellular Locus:

    Cytoplasm | Membrane | Nucleus
  • Host:

    E. coli
  • Origin Species:

    Rat
  • Target:

    Alpha Synuclein
  • Conjugation:

    No Tag
  • Sequence:

    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA
  • Applications:

    WB, SDS-PAGE, In vivo assay, In vitro assay
  • Purification Method:

    Ion-exchange Purified
  • Concentration:

    2 mg/ml
  • Purity:

    >95%
  • Weight:

    0.02
  • Length:

    Full Length
  • Buffer:

    PBS pH 7.4
  • Molecular Weight:

    14.515 kDa
  • Precautions:

    Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
  • Additionnal Information:

    For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information. Monomer source is catalog# SPR-481.
  • References & Citations:

    1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013). 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840. 6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757. 7. Polymeropoulos, M. H. (1998). Science. 276(5321), 2045–2047 8. Conway, K.E., et al. (1998). Nat Med. 4(11):1318-20

MSDS

MSDS Document

View Document