Recombinant Human Gamma-aminobutyric acid receptor-associated protein (GABARAP)

CAT:
399-CSB-YP009130HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Gamma-aminobutyric acid receptor-associated protein (GABARAP) - image 1

Recombinant Human Gamma-aminobutyric acid receptor-associated protein (GABARAP)

  • Product Name Alternative:

    GABA (A) receptor-associated protein; MM46
  • Abbreviation:

    Recombinant Human GABARAP protein
  • Gene Name:

    GABARAP
  • UniProt:

    O95166
  • Expression Region:

    1-116aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG
  • Tag:

    C-terminal 6xHis-tagged
  • Type:

    In Stock Protein
  • Source:

    Yeast
  • Field of Research:

    Transport
  • Relevance:

    Ubiquitin-like modifier that plays a role in intracellular transport of GABA (A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore mbrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    15.3 kDa
  • References & Citations:

    The human homolog of Saccharomyces cerevisiae Apg7p is a Protein-activating enzyme for multiple substrates including human Apg12p, GATE-16, GABARAP, and MAP-LC3.Tanida I., Tanida-Miyake E., Ueno T., Kominami E.J. Biol. Chem. 276:1701-1706 (2001)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length