Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B), partial

CAT:
399-CSB-MP008544HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B), partial - image 1

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B), partial

  • Product Name Alternative:

    Fc-gamma RIII-beta; CD16-I; Fc-gamma RIII; Fc-gamma RIIIb; FcRIII; FcRIIIb; FcR-10; IgG Fc receptor III-1; CD antigen CD16b
  • Abbreviation:

    Recombinant Human FCGR3B protein, partial
  • Gene Name:

    FCGR3B
  • UniProt:

    O75015
  • Expression Region:

    17-200aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS
  • Tag:

    C-terminal 10xHis-tagged
  • Type:

    In Stock Protein
  • Source:

    Mammalian cell
  • Field of Research:

    Immunology
  • Relevance:

    Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    20.8 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial