Recombinant Human Caveolin-1 (CAV1)

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
Y080094	Anti-Caveolin 1/3(Caveolin 1+ Caveolin 3) Antibody
MBS286537-01	Recombinant Human Caveolin-1 (CAV1) Protein
MBS286537-04	Recombinant Human Caveolin-1 (CAV1) Protein
AP81035	Caveolin-1
AP81221	Caveolin-1
AP81352	Caveolin-1
AP81360	Caveolin-1
AP81634	Caveolin-1
MBS200503-02	Caveolin-1
MBS8565204-02	Caveolin-1

CAT:

399-CSB-CF004571HU(A4)-01

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Caveolin-1 (CAV1)

Gene Name: CAV1
UniProt: Q03135
Expression Region: 1-178aa
Organism: Homo sapiens
Target Sequence: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
Tag: N-terminal 10xHis-tagged
Source: in vitro E.coli expression system
Field of Research: Cancer
Assay Type: CF Transmembrane Protein & Developed Protein
Relevance: May act as a scaffolding protein within caveolar membranes. Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway. Negatively regulates TGFB1-mediated activation of SMAD2/3 by mediating the internalization of TGFBR1 from membrane rafts leading to its subsequent degradation . Binds 20 (S)-hydroxycholesterol (20 (S)-OHC).
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 22 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Caveolin-1 (CAV1), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
CSB-CF004571HU(A4)-01	Recombinant Human Caveolin-1 (CAV1)
CSB-CF004571HU(A4)-02	Recombinant Human Caveolin-1 (CAV1)
CSB-EP004571RA-02	Recombinant Rat Caveolin-1 (Cav1)
CSB-EP004571RA-01	Recombinant Rat Caveolin-1 (Cav1)
CSB-YP004571DO-02	Recombinant Dog Caveolin-1 (CAV1)
CSB-YP004571DO-03	Recombinant Dog Caveolin-1 (CAV1)
CSB-EP004571RA-03	Recombinant Rat Caveolin-1 (Cav1)
CSB-YP004571DO-01	Recombinant Dog Caveolin-1 (CAV1)
CSB-E09682h-04	Human Caveolin-1, Cav-1 ELISA Kit
CSB-E09682h-01	Human Caveolin-1, Cav-1 ELISA Kit