Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active)

Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active)

• CAS Number: 9000-83-3
• Gene Name: TSPAN8-VLPs
• UniProt: P19075
• Expression Region: 1-237aa
• Organism: Homo sapiens
• Target Sequence: MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK
• Tag: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
• Source: Mammalian cell
• Field of Research: Cancer
• Assay Type: MP-VLP Transmembrane Protein & Active Protein & In Stock Protein
• Relevance: Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling.
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: The purity information is not available for VLPs proteins.
• Activity: Yes
• Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5 μg/mL can bind Anti-TSPAN8 recombinant antibody (CSB-RA025166MA1HU). The EC50 is 2.261-2.623 ng/mL.The VLPs (CSB-MP3838) is negative control.
• Length: Full Length
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle miXIng. Avoid vigorous shaking or vorteXIng.
• Molecular Weight: 27.4 kDa
• References & Citations: Silencing of long non-coding RNA SOX21-AS1 inhibits lung adenocarcinoma invasion and migration by impairing TSPAN8 via transcription factor GATA6. Xu Y., Wu H., Wu L., Xu L., Li J., Wang Q., Pu X. Int J Biol Macromol 164:1294-1303 (2020)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.