GNLY Protein
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


GNLY Protein
Gene Aliases:
LAG2, NKG5, LAG-2, D2S69E, TLA519Gene ID:
10578Accession Number:
NP_006424.2Reactivity:
HumanTarget:
GNLY is part of the SAPLIP family and is located in the cytotoxic granules of T cells, which are discharged upon antigen stimulation. GNLY is localized in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. GNLY is an antimicrobial protein that kills intracellular pathogens. GNLY is active against a wide range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis. GNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids.Type:
ProteinSource:
E. ColiSequence:
MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYD LARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYR TCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWR DVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPS TGPLGSHHHHHHPurification:
The GNLY is purified by proprietary chromatographic techniques.Assay Protocol:
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) ProtocolConcentration:
1 mg/ml (prior to lyophilization)Format:
Lyophilized// from a concentrated (1 mg/ml) solution containing no additives. Physical appearance:// Sterile filtered white powderPhysical appearance:// Sterile filtered white powderReconstitution:
2Please prevent freeze-thaw cycles.//Molecular Weight:
18.1 kDaNotes:
Formerly GWB-BSP494Protein Length:
RecombinantNCBI Gene Symbol:
GNLYProtein Name:
GranulysinGene Name URL:
GNLY
