TFF1 Protein

• Gene Aliases :

  PS2, BCEI, HPS2, HP1.A, pNR-2, D21S21

• Gene ID :

  7031

• Accession Number :

  NP_003216.1

• Reactivity :

  Human

• Target :

  Recombinant Human Trefoil Factor-1

• Type :

  Protein

• Sequence :

  EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF.

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  The protein was lyophilized after dialysis against 1xPBS pH-7.4. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

• Reconstitution :

  Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution TFF1 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.

• Notes :

  Formerly GWB-9772A0

• Protein Length :

  Recombinant

• NCBI Gene Symbol :

  TFF1

• Host or Source :

  E. Coli

• Protein Name :

  Trefoil factor 1

• Gene Name URL :

  TFF1