CCL16 Protein

• Gene Aliases:

  LEC, LMC, NCC4, CKb12, HCC-4, LCC-1, Mtn-1, NCC-4, SCYL4, ILINCK, SCYA16

• Gene ID:

  6360

• Accession Number:

  NP_004581.1

• Reactivity:

  Human

• Target:

  Recombinant Human LEC/NCC-4 (CCL16)

• Type:

  Protein

• Sequence:

  QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ.

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  The CCL16 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

• Reconstitution:

  Lyophilized CCL16 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution CCL16 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.

• Notes:

  Formerly GWB-E12E32

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  CCL16

• Host or Source:

  E. Coli

• Protein Name:

  C-C motif chemokine 16

• Gene Name URL:

  CCL16