TXN1 E.Coli Protein
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


TXN1 E.Coli Protein
Gene Aliases :
DasC, ECK3773, fipA, tsnCGene ID :
948289Accession Number :
AP_004016.1Reactivity :
Escherichia coliTarget :
Recombinant E.Coli ThioredoxinType :
ProteinSequence :
HMSDKIIHL TDDSFDTDVLKADGAIL VDFW AEWCGPCKMIAPILDEI GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL DANLA.Assay Protocol :
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) ProtocolFormat :
Each mg of protein contains 20mM phosphate buffer pH 7.4. Physical appearance: Sterile Lyophilized Powder.Reconstitution :
TRX although stable at 4C for 3 weeks, should be stored desiccated below -18C. Please prevent freeze thaw cycles.Notes :
Formerly GWB-97AB0FProtein Length :
RecombinantNCBI Gene Symbol :
TXN1Host or Source :
E. ColiProtein Name :
Thioredoxin-1Gene Name URL :
TXN1

