UBE2D3 Protein

• Gene Aliases:

  UBC4/5, UBCH5C, E2 (17) KB3

• Gene ID:

  7323

• Accession Number:

  NP_003331.1

• Reactivity:

  Human

• Target:

  Recombinant Human Ubiquitin Conjugating Enzyme E2D3

• Type:

  Protein

• Sequence:

  MHHHHHHAMALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM.

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Lyophilized from a 0.2um filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5. Physical appearance: Sterile Filtered white lyophilized powder.

• Reconstitution:

  Lyophilized UBE2D3 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution UBE2D3 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.

• Notes:

  Formerly GWB-E4AC60

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  UBE2D3

• Host or Source:

  E. Coli

• Protein Name:

  Ubiquitin-conjugating enzyme E2 D3

• Gene Name URL:

  UBE2D3