UBE2D3 Protein

CAT:
247-OPPA00860-2UG
Size:
2 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
UBE2D3 Protein - image 1

UBE2D3 Protein

  • Gene Aliases:

    UBC4/5, UBCH5C, E2 (17) KB3
  • Gene ID:

    7323
  • Accession Number:

    NP_003331.1
  • Reactivity:

    Human
  • Target:

    Recombinant Human Ubiquitin Conjugating Enzyme E2D3
  • Type:

    Protein
  • Sequence:

    MHHHHHHAMALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM.
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Lyophilized from a 0.2um filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5. Physical appearance: Sterile Filtered white lyophilized powder.
  • Reconstitution:

    Lyophilized UBE2D3 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution UBE2D3 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.
  • Notes:

    Formerly GWB-E4AC60
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    UBE2D3
  • Host or Source:

    E. Coli
  • Protein Name:

    Ubiquitin-conjugating enzyme E2 D3
  • Gene Name URL:

    UBE2D3