CLDN6 Recombinant Protein (Human)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CLDN6 Recombinant Protein (Human)
Gene Name:
Claudin 6Gene Aliases:
Claudin-6; skullin.Gene ID:
9074Accession Number:
NP_067018Reactivity:
Homo sapiens|HumanTarget:
Plays a major role in tight junction-specific obliteration of the intercellular space.Type:
ProteinSource:
E.coliSequence:
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARAPurification:
Affinity purified using IMACAssay Protocol:
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) ProtocolConcentration:
Varies by lot. See vial for concentration.Format:
Liquid or Lyophilized powderReconstitution:
-20°C or -80°CMolecular Weight:
24.8 kDaProtein Length:
RecombinantNCBI Gene Symbol:
CLDN6Protein Name:
Claudin-6Gene Name URL:
CLDN6CAS Number:
9000-83-3Nucleotide Accession Number:
NM_021195
