MOCS2 Recombinant Protein (Human)

• Gene Name:

  Molybdenum cofactor synthesis 2

• Gene Aliases:

  MCBPE; MOCO1; MOCO1-B; MOCODB; molybdenum cofactor biosynthesis protein E; Molybdenum cofactor synthesis protein 2 large subunit; Molybdenum cofactor synthesis protein 2B; molybdopterin synthase catalytic subunit; molybdopterin synthase sulfur carrier subunit; Molybdopterin-synthase large subunit; MPTS.

• Gene ID:

  4338

• Accession Number:

  NP_004522

• Reactivity:

  Homo sapiens|Human

• Target:

  Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  47.9 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  MOCS2

• Protein Name:

  Molybdopterin synthase catalytic subunit

• Gene Name URL:

  MOCS2

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_004531