NDUFB10 Recombinant Protein (Human)

CAT:
247-OPCA05026-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
NDUFB10 Recombinant Protein (Human) - image 1

NDUFB10 Recombinant Protein (Human)

  • Gene Name:

    NADH:ubiquinone oxidoreductase subunit B10
  • Gene Aliases:

    CI-PDSW; complex I PDSW subunit; complex I-PDSW; MC1DN35; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10; NADH ubiquinone oxidoreductase PDSW subunit (RH 16p13.3) ; NADH-ubiquinone oxidoreductase PDSW subunit; PDSW.
  • Gene ID:

    4716
  • Accession Number:

    NP_004539
  • Reactivity:

    Homo sapiens|Human
  • Target:

    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    47.8 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    NDUFB10
  • Protein Name:

    NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
  • Gene Name URL:

    NDUFB10
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_004548