SNAP29 Recombinant Protein (Human)

CAT:
247-OPCA04994-1MG
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SNAP29 Recombinant Protein (Human) - image 1

SNAP29 Recombinant Protein (Human)

  • Gene Name:

    Synaptosome associated protein 29
  • Gene Aliases:

    CEDNIK; cerebral dysgenesis, neuropathy, ichthyosis and keratoderma syndrome; SNAP-29; soluble 29 kDa NSF attachment protein; synaptosomal-associated protein 29; synaptosomal-associated protein, 29kD; synaptosomal-associated protein, 29kDa; synaptosome associated protein 29kDa; vesicle-membrane fusion protein SNAP-29.
  • Gene ID:

    9342
  • Accession Number:

    NP_004773
  • Reactivity:

    Homo sapiens|Human
  • Target:

    SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysososome membrane. Plays also a role in ciliogenesis by regulating membrane fusions.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    56 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    SNAP29
  • Protein Name:

    Synaptosomal-associated protein 29
  • Gene Name URL:

    SNAP29
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_004782