GTF2A2 Recombinant Protein (Human)

• Gene Name:

  General transcription factor IIA subunit 2

• Gene Aliases:

  General transcription factor IIA 2; General transcription factor IIA subunit 2; general transcription factor IIA, 2, 12kDa; HsT18745; T18745; TF2A2; TFIIA; TFIIA gamma subunit; TFIIA p12 subunit; TFIIA-12; TFIIA-gamma; TFIIAS; transcription initiation factor IIA gamma chain; transcription initiation factor IIA subunit 2.

• Gene ID:

  2958

• Accession Number:

  NP_001307858

• Reactivity:

  Homo sapiens|Human

• Target:

  TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  39.5 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  GTF2A2

• Protein Name:

  Transcription initiation factor IIA subunit 2

• Gene Name URL:

  GTF2A2

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001320929