GTF2A2 Recombinant Protein (Human)

CAT:
247-OPCA04952-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
GTF2A2 Recombinant Protein (Human) - image 1

GTF2A2 Recombinant Protein (Human)

  • Gene Name:

    General transcription factor IIA subunit 2
  • Gene Aliases:

    General transcription factor IIA 2; General transcription factor IIA subunit 2; general transcription factor IIA, 2, 12kDa; HsT18745; T18745; TF2A2; TFIIA; TFIIA gamma subunit; TFIIA p12 subunit; TFIIA-12; TFIIA-gamma; TFIIAS; transcription initiation factor IIA gamma chain; transcription initiation factor IIA subunit 2.
  • Gene ID:

    2958
  • Accession Number:

    NP_001307858
  • Reactivity:

    Homo sapiens|Human
  • Target:

    TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    39.5 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    GTF2A2
  • Protein Name:

    Transcription initiation factor IIA subunit 2
  • Gene Name URL:

    GTF2A2
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_001320929