HIST1H3A MORE Recombinant Protein (Human)

CAT:
247-OPCA04930-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
HIST1H3A MORE Recombinant Protein (Human) - image 1

HIST1H3A MORE Recombinant Protein (Human)

  • Gene Name:

    H3 clustered histone 1|H3 clustered histone 10|H3 clustered histone 11|H3 clustered histone 12|H3 clustered histone 2|H3 clustered histone 3|H3 clustered histone 4|H3 clustered histone 6|H3 clustered histone 7|H3 clustered histone 8
  • Gene Aliases:

    H3 histone family, member A; H3 histone family, member B; H3 histone family, member C; H3 histone family, member D; H3 histone family, member F; H3 histone family, member H; H3 histone family, member I; H3 histone family, member J; H3 histone family, member K; H3 histone family, member L; H3.1; H3.f; H3/A; H3/b; H3/c; H3/d; H3/f; H3/h; H3/i; H3/j; H3/k; H3/l; H3C1; H3C10; H3C11; H3C12; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3F1K; H3FA; H3FB; H3FC; H3FD; H3FF; H3FH; H3FI; H3FJ; H3FK; H3FL; HIST1H3A; HIST1H3B; HIST1H3C; HIST1H3D; HIST1H3E; HIST1H3F; HIST1H3G; HIST1H3H; HIST1H3I; HIST1H3J; histone 1, H3a; histone 1, H3b; histone 1, H3c; histone 1, H3d; histone 1, H3e; histone 1, H3f; histone 1, H3g; histone 1, H3h; histone 1, H3i; histone 1, H3j; histone cluster 1 H3 family member a; histone cluster 1 H3 family member b; histone cluster 1 H3 family member c; histone cluster 1 H3 family member d; histone cluster 1 H3 family member e; histone cluster 1 H3 family member f; histone cluster 1 H3 family member g; histone cluster 1 H3 family member h; histone cluster 1 H3 family member i; histone cluster 1 H3 family member j; histone cluster 1, H3a; histone cluster 1, H3b; histone cluster 1, H3c; histone cluster 1, H3d; histone cluster 1, H3e; histone cluster 1, H3f; histone cluster 1, H3g; histone cluster 1, H3h; histone cluster 1, H3i; histone cluster 1, H3j; histone H3.1; histone H3/a; histone H3/b; histone H3/c; histone H3/d; histone H3/f; histone H3/h; histone H3/i; histone H3/j; histone H3/k; histone H3/l.
  • Gene ID:

    8350|8351|8352|8353|8354|8355|8356|8357|8358|8968
  • Accession Number:

    NP_003520
  • Reactivity:

    Homo sapiens|Human
  • Target:

    Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    42.3 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    H3C1|H3C10|H3C11|H3C12|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8
  • Protein Name:

    Histone H3.1
  • Gene Name URL:

    H3C1|H3C10|H3C11|H3C12|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_003529