EIF3E Recombinant Protein (Human)EIF3E Recombinant Protein (Human) - High-quality laboratory reagent available from Gentaur. Catalog: 247-OPCA04735-100UG.247-OPCA04735-100UG247-OPCA04735-100UGBusiness & Industrial > Science & LaboratoryEIF3E Recombinant Protein (Human)
Gentaur
EUR12027-02-21

EIF3E Recombinant Protein (Human)

CAT:
247-OPCA04735-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
EIF3E Recombinant Protein (Human) - image 1

EIF3E Recombinant Protein (Human)

  • Gene Name:

    Eukaryotic translation initiation factor 3 subunit E
  • Gene Aliases:

    EIF-3 p48; eIF3-p46; EIF3-P48; EIF3S6; eukaryotic translation initiation factor 3 subunit 6; eukaryotic translation initiation factor 3 subunit E; eukaryotic translation initiation factor 3, subunit 6 (48kD) ; eukaryotic translation initiation factor 3, subunit 6 48kDa; INT6; mammary tumor-associated protein INT6; murine mammary tumor integration site 6 (oncogene homolog) ; viral integration site protein INT-6 homolog.
  • Gene ID:

    3646
  • Accession Number:

    NP_001559
  • Reactivity:

    Homo sapiens|Human
  • Target:

    Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815) . The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC) . The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed:17581632) . The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed:25849773) . Required for nonsense-mediated mRNA decay (NMD) ; may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway (PubMed:17468741) . May interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins (PubMed:17310990, PubMed:17324924) .
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
  • Purification:

    Affinity purified using AC
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration:

    Varies by lot. See vial for exact concentration.
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    79.1 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    EIF3E
  • Protein Name:

    Eukaryotic translation initiation factor 3 subunit E
  • Gene Name URL:

    EIF3E
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_001568