Products for Research Use Only
RegisterLogin

RAB8A Recombinant Protein (Human)

CAT: 0247-OPCA04488-100UGSize: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA04488-100UGSize:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Name
RAB8A, member RAS oncogene family
Gene Aliases
MEL; mel transforming oncogene (derived from cell line NK14) ; mel transforming oncogene (derived from cell line NK14) - RAB8 homolog; mel transforming oncogene (RAB8 homolog) ; oncogene c-mel; RAB8; ras-associated protein RAB8; ras-related protein Rab-8A.
Gene ID
4218
Accession Number
NP_005361
Reactivity
Homo sapiens|Human
Target
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in polarized vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis (PubMed:20890297) . Together with MYO5B and RAB11A participates in epithelial cell polarization (PubMed:21282656) . Plays an important role in ciliogenesis (PubMed:21844891) . Together with MICALL2, may also regulate adherens junction assembly (By similarity) . May play a role in insulin-induced transport to the plasma membrane of the glucose transporter GLUT4 and therefore play a role in glucose homeostasis (By similarity) . Involved in autophagy (PubMed:27103069) .
Type
Protein
Source
E.coli
Sequence
KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
37.8 kDa
Protein Length
Recombinant
NCBI Gene Symbol
RAB8A
Protein Name
Ras-related protein Rab-8A
Gene Name URL
RAB8A
Nucleotide Accession Number
NM_005370

Related Products

CatalogName
OCOA12646-20UGRAB8A Protein Lysate
OAEB01616-100UGRAB8A Antibody
OKEH02358-96WRAB8A ELISA Kit (Human)
OOCA01396-25TOOCA01396-25T - Human RAB8A Primer Pair
ARP87262_P050-25ULRAB8A Antibody - middle region
OKEH08030-96WRAB8A ELISA Kit (Dog)
OKEH08029-96WRAB8A ELISA Kit (Bovine)
OKEH05489-96WRAB8A ELISA Kit (Mouse)
OKEH06647-96WRAB8A ELISA Kit (Chicken)
AVARP13076_P050-25ULRAB8A Antibody - middle region

Alternative Products

CatalogName
RP085929RAB8A Recombinant Protein (Human)
E30P12651Recombinant Human RAB8A Protein
PPT-14896Human RAB8A Recombinant Protein
MBS7612965-01Recombinant Human RAB8A
TP300675MRAB8A (NM_005370) Human Recombinant Protein
GTR18883689-01Human RAB8A protein
RP223394RAB8A Recombinant Protein (Rat)
RP166376RAB8A Recombinant Protein (Mouse)
H00004218-Q01-10ugRecombinant Human RAB8A Protein - (Dry Ice)
ARO-P12508-01Recombinant Human RAB8A Protein, N-His

Popular Products