RAB8A Recombinant Protein (Human)

• Gene Name:

  RAB8A, member RAS oncogene family

• Gene Aliases:

  MEL; mel transforming oncogene (derived from cell line NK14) ; mel transforming oncogene (derived from cell line NK14) - RAB8 homolog; mel transforming oncogene (RAB8 homolog) ; oncogene c-mel; RAB8; ras-associated protein RAB8; ras-related protein Rab-8A.

• Gene ID:

  4218

• Accession Number:

  NP_005361

• Reactivity:

  Homo sapiens|Human

• Target:

  The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in polarized vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis (PubMed:20890297) . Together with MYO5B and RAB11A participates in epithelial cell polarization (PubMed:21282656) . Plays an important role in ciliogenesis (PubMed:21844891) . Together with MICALL2, may also regulate adherens junction assembly (By similarity) . May play a role in insulin-induced transport to the plasma membrane of the glucose transporter GLUT4 and therefore play a role in glucose homeostasis (By similarity) . Involved in autophagy (PubMed:27103069) .

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  37.8 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  RAB8A

• Protein Name:

  Ras-related protein Rab-8A

• Gene Name URL:

  RAB8A

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_005370