AMELX Recombinant Protein (Human)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


AMELX Recombinant Protein (Human)
Gene Name:
Amelogenin X-linkedGene Aliases:
AI1E; AIH1; ALGN; amelogenin (amelogenesis imperfecta 1, X-linked) ; amelogenin (X chromosome, amelogenesis imperfecta 1) ; amelogenin, X isoform; AMG; AMGL; AMGX.Gene ID:
265Accession Number:
NP_001133Reactivity:
Homo sapiens|HumanTarget:
Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel.Type:
ProteinSource:
E.coliSequence:
MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVDPurification:
Affinity purified using IMAC.Assay Protocol:
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) ProtocolFormat:
Liquid or Lyophilized powderReconstitution:
-20°C or -80°CMolecular Weight:
35.9 kDaProtein Length:
RecombinantNCBI Gene Symbol:
AMELXProtein Name:
Amelogenin, X isoformGene Name URL:
AMELXCAS Number:
9000-83-3Nucleotide Accession Number:
NM_001142
