Products for Research Use Only
RegisterLogin

CLEC4E Recombinant Protein (Mouse)

CAT: 0247-OPCA04325-1MGSize: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA04325-1MGSize:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Name
C-type lectin domain family 4, member e
Gene Aliases
C86253; Clecs; Clecsf9; C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 9; C-type lectin domain family 4 member E; C-type lectin superfamily member 9; C-type lectin, superfamily member 9; macrophage-inducible C-type lectin; Min; Mincle.
Gene ID
56619
Accession Number
NP_064332
Reactivity
Mouse|Mus musculus
Target
A calcium-dependent lectin that acts as a pattern recognition receptor of the innate immune system. Recognizes damage-associated molecular patterns (DAMPs) of abnormal self and pathogen-associated molecular patterns (PAMPs) of bacteria and fungi (PubMed:18509109, PubMed:19171887, PubMed:23602766, PubMed:18776906) . The PAMPs notably include mycobacterial trehalose 6,6'-dimycolate (TDM), a cell wall glycolipid with potent adjuvant immunomodulatory functions (PubMed:23602766) . Interacts with signaling adapter Fc receptor gamma chain/FCER1G to form a functional complex in myeloid cells (PubMed:23602766, PubMed:18776906) . Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes (PubMed:23602766) . Specifically recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia and mediates macrophage activation (PubMed:19171887) . Through recognition of DAMPs released upon nonhomeostatic cell death, enables immune sensing of damaged self and promotes inflammatory cell infiltration into the damaged tissue (PubMed:18776906) .
Type
Protein
Source
E.coli
Sequence
TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
23.6 kDa
Protein Length
Recombinant
NCBI Gene Symbol
Clec4e
Protein Name
C-type lectin domain family 4 member E
Gene Name URL
Clec4e
Nucleotide Accession Number
NM_019948

Related Products

CatalogName
OCOA11178-20UGCLEC4E Protein Lysate
OAPA00364-5UGCLEC4E Antibody
OACA06458-100UGCLEC4E Antibody
OACA06458-50UGCLEC4E Antibody
ARP82134_P050-25ULCLEC4E Antibody - middle region
ARP77262_P050-25ULCLEC4E Antibody - middle region
OKEH01148-96WCLEC4E ELISA Kit (Human)
OPCA05222-1MGCLEC4A Recombinant Protein (Mouse)
OPCA05222-100UGCLEC4A Recombinant Protein (Mouse)
OPCA05222-20UGCLEC4A Recombinant Protein (Mouse)

Alternative Products

CatalogName
PPT-16460Mouse CLEC4E Recombinant Protein
RP124649CLEC4E Recombinant Protein (Mouse)
91-525CLEC4E Recombinant Protein
TP502353Clec4e (NM_019948) Mouse Recombinant Protein
GTR18881943-01Mouse Clec4e protein
NBP2-13844PEPCLEC4E Recombinant Protein Antigen
RP007312CLEC4E Recombinant Protein (Human)
NBP2-52028-0.1mgRecombinant Human CLEC4E Protein
RP195329CLEC4E Recombinant Protein (Rat)
MA858012-01Recombinant Mouse CLEC4E Protein, N-His

Popular Products