HSD17B10 Recombinant Protein (Human)

• Gene Name:

  Hydroxysteroid 17-beta dehydrogenase 10

• Gene Aliases:

  17-beta-hydroxysteroid dehydrogenase 10;17b-HSD10;2-methyl-3-hydroxybutyryl-CoA dehydrogenase;3-hydroxy-2-methylbutyryl-CoA dehydrogenase;3-hydroxyacyl-CoA dehydrogenase type II;3-hydroxyacyl-CoA dehydrogenase type-2; ABAD; AB-binding alcohol dehydrogenase; amyloid-beta peptide binding alcohol dehydrogenase; CAMR; DUPXp11.22; endoplasmic reticulum-associated amyloid beta-peptide-binding protein; ERAB; HADH2; HCD2; HSD10MD; MHBD; mitochondrial ribonuclease P protein 2; mitochondrial RNase P subunit 2; MRPP2; MRX17; MRX31; MRXS10; SCHAD; SDR5C1; Short chain dehydrogenase/reductase family 5C member 1; short chain L-3-hydroxyacyl-CoA dehydrogenase type 2; short chain type dehydrogenase/reductase XH98G2; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH.

• Gene ID:

  3028

• Accession Number:

  NP_001032900

• Reactivity:

  Homo sapiens|Human

• Target:

  Mitochondrial dehydrogenase that catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone (PubMed:9553139, PubMed:23042678, PubMed:12917011, PubMed:18996107, PubMed:25925575, PubMed:28888424) . Catalyzes the third step in the beta-oxidation of fatty acids (PubMed:9553139, PubMed:12917011, PubMed:18996107, PubMed:25925575, PubMed:28888424) . Carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids (PubMed:12917011) . Also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids (PubMed:12917011) . By interacting with intracellular amyloid-beta, it may contribute to the neuronal dysfunction associated with Alzheimer disease (AD) (PubMed:9338779) . Essential for structural and functional integrity of mitochondria (PubMed:20077426) .

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  AAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

• Purification:

  Affinity purified using IMAC

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  Varies by lot. See vial for concentration.

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  42.8 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  HSD17B10

• Protein Name:

  3-hydroxyacyl-CoA dehydrogenase type-2

• Gene Name URL:

  HSD17B10

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001037811