HSD17B11 Recombinant Protein (Human)

• Gene Name:

  Hydroxysteroid 17-beta dehydrogenase 11

• Gene Aliases:

  17-BETA-HSD11;17-BETA-HSDXI;17-beta-hydroxysteroid dehydrogenase 11;17-beta-hydroxysteroid dehydrogenase type XI;17-beta-hydroxysteroid dehydrogenase XI;17BHSD11; CTCL tumor antigen HD-CL-03; CTCL-associated antigen HD-CL-03; cutaneous T-cell lymphoma-associated antigen HD-CL-03; dehydrogenase/reductase SDR family member 8; DHRS8; estradiol 17-beta-dehydrogenase 11; PAN1B; retinal short-chain dehydrogenase/reductase 2; RETSDR2; SDR16C2; short chain dehydrogenase/reductase family 16C member 2.

• Gene ID:

  51170

• Accession Number:

  NP_057329

• Reactivity:

  Homo sapiens|Human

• Target:

  Can convert androstan-3-alpha,17-beta-diol (3-alpha-diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. May act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it. Has no activity toward DHEA (dehydroepiandrosterone), or A-dione (4-androste-3,17-dione), and only a slight activity toward testosterone to A-dione. Tumor-associated antigen in cutaneous T-cell lymphoma.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  ESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  46.8 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  HSD17B11

• Protein Name:

  Estradiol 17-beta-dehydrogenase 11

• Gene Name URL:

  HSD17B11

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_016245