SULT1A3 Recombinant Protein (Human)

• Gene Name:

  Sulfotransferase family 1A member 3|sulfotransferase family 1A member 4

• Gene Aliases:

  Aryl sulfotransferase 1A3/1A4; catecholamine-sulfating phenol sulfotransferase; dopamine-specific sulfotransferase; HAST; HAST3; monoamine-sulfating phenol sulfotransferase; monoamine-sulfating phenosulfotransferase; M-PST; phenol sulfotransferase 1A5; placental estrogen sulfotransferase; SLX1B-SULT1A4; ST1A3; ST1A3/ST1A4; ST1A4; ST1A5; STM; sulfokinase; sulfotransferase 1A3; Sulfotransferase 1A3/1A4; Sulfotransferase 1A4; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4; sulfotransferase, monoamine-preferring; thermolabile (monoamine, M form) phenol sulfotransferase; thermolabile phenol sulfotransferase; TL-PST.

• Gene ID:

  445329|6818

• Accession Number:

  NP_001017390

• Reactivity:

  Homo sapiens|Human

• Target:

  Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  50.2 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  SULT1A3|SULT1A4

• Protein Name:

  Sulfotransferase 1A3

• Gene Name URL:

  SULT1A3|SULT1A4

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001017390