CCL25 Recombinant Protein (Human)

CAT:
247-OPCA03822-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CCL25 Recombinant Protein (Human) - image 1

CCL25 Recombinant Protein (Human)

  • Gene Name:

    C-C motif chemokine ligand 25
  • Gene Aliases:

    C-C motif chemokine 25; chemokine (C-C motif) ligand 25; chemokine TECK; Ck beta-15; Ckb15; SCYA25; small inducible cytokine subfamily A (Cys-Cys), member 25; small-inducible cytokine A25; TECK; TECKvar; thymus expressed chemokine; Thymus-expressed chemokine.
  • Gene ID:

    6370
  • Accession Number:

    NP_001188288
  • Reactivity:

    Homo sapiens|Human
  • Target:

    Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    41.2 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    CCL25
  • Protein Name:

    C-C motif chemokine 25
  • Gene Name URL:

    CCL25
  • CAS Number:

    9000-83-3
  • Nucleotide Accession Number:

    NM_001201359