ASPH Recombinant Protein (Human)

• Gene Name:

  Aspartate beta-hydroxylase

• Gene Aliases:

  A beta H-J-J; AAH; ASP beta-hydroxylase; Aspartate beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase; BAH; cardiac junctin; CASQ2BP1; FDLAB; HAAH; humbug; JCTN; junctate; junctin; peptide-aspartate beta-dioxygenase.

• Gene ID:

  444

• Accession Number:

  NP_001158222

• Reactivity:

  Homo sapiens|Human

• Target:

  Isoform 1: specifically hydroxylates an Asp or Asn residue in certain epidermal growth factor-like (EGF) domains of a number of proteins.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  38.2 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  ASPH

• Protein Name:

  Aspartyl/asparaginyl beta-hydroxylase

• Gene Name URL:

  ASPH

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001164750