FABP3 Recombinant Protein

• Gene Name:

  Fatty acid binding protein 3

• Gene Aliases:

  Fatty acid binding protein 3 heart; fatty acid binding protein 3, muscle and heart; Fatty acid-binding protein 3; fatty acid-binding protein, heart; heart fatty acid binding protein; heart-type fatty acid-binding protein; H-FABP.

• Gene ID:

  79131

• Accession Number:

  NP_077076.1

• Reactivity:

  Rat|Rattus norvegicus

• Target:

  FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

• Type:

  Protein

• Source:

  Mammalian Cells

• Sequence:

  ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  18.6 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  Fabp3

• Host or Source:

  Rat

• Protein Name:

  Fatty acid-binding protein, heart

• Gene Name URL:

  Fabp3

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_024162.1