PAK7 Recombinant Protein

CAT:
247-OPCA03685-20UG
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PAK7 Recombinant Protein - image 1

PAK7 Recombinant Protein

  • Gene Name :

    P21 (RAC1) activated kinase 5
  • Gene Aliases :

    P21 (RAC1) activated kinase 7; p21 protein (Cdc42/Rac) -activated kinase 7; p21 (CDKN1A) -activated kinase 7; p21-activated kinase 5; p21-activated kinase 7; p21CDKN1A-activated kinase 7; PAK-5; PAK7; PAK-7; protein kinase PAK5; serine/threonine-protein kinase PAK 5; serine/threonine-protein kinase PAK 7; serine/threonine-protein kinase PAK7.
  • Gene ID :

    57144
  • Accession Number :

    NP_065074.1
  • Reactivity :

    Homo sapiens|Human
  • Target :

    Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, proliferation or cell survival. Activation by various effectors including growth factor receptors or active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates the proto-oncogene RAF1 and stimulates its kinase activity. Promotes cell survival by phosphorylating the BCL2 antagonist of cell death BAD. Phosphorylates CTNND1, probably to regulate cytoskeletal organization and cell morphology. Keeps microtubules stable through MARK2 inhibition and destabilizes the F-actin network leading to the disappearance of stress fibers and focal adhesions.
  • Type :

    Protein
  • Source :

    Baculovirus
  • Sequence :

    MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid or Lyophilized powder
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    -20°C or -80°C
  • Molecular Weight :

    34.9 kDa
  • Protein Length :

    Recombinant
  • NCBI Gene Symbol :

    PAK5
  • Host or Source :

    Human
  • Protein Name :

    Serine/threonine-protein kinase PAK 5
  • Gene Name URL :

    PAK5
  • CAS Number :

    9000-83-3
  • Nucleotide Accession Number :

    NM_020341.3

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide

PAK7 Recombinant Protein | | Buy Online at Best Prices | Gentaur | Gentaur