SALL2 Recombinant Protein

• Gene Name :

  Spalt like transcription factor 2

• Gene Aliases :

  COLB; HSAL2; p150 (Sal2) ; Sal-2; sal-like protein 2; zinc finger protein 795; zinc finger protein SALL2; zinc finger protein Spalt-2; ZNF795.

• Gene ID :

  6297

• Accession Number :

  NP_001278375.1

• Reactivity :

  Homo sapiens|Human

• Target :

  Probable transcription factor that plays a role in eye development before, during, and after optic fissure closure.

• Type :

  Protein

• Source :

  Mammalian Cells

• Sequence :

  QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid or Lyophilized powder

• Buffer :

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution :

  -20°C or -80°C

• Molecular Weight :

  25.3 kDa

• Protein Length :

  Recombinant

• NCBI Gene Symbol :

  SALL2

• Host or Source :

  Human

• Protein Name :

  Sal-like protein 2

• Gene Name URL :

  SALL2

• CAS Number :

  9000-83-3

• Nucleotide Accession Number :

  NM_001291446.1