RegisterLogin

GP Recombinant Protein

CAT: 0247-OPCA03666-20UGSize: 20 µgDry Ice: NoHazardous: No
CAT#:0247-OPCA03666-20UGSize:20 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
CAS Number
9000-83-3
Gene Name
Second secreted glycoprotein; small secreted glycoprotein; spike glycoprotein
Gene Aliases
GP1,2; second secreted glycoprotein; small secreted glycoprotein; spike glycoprotein; SEVgp4.
Gene ID
3160774
Reactivity
Sudan Ebola Virus
Target
GP1 is responsible for binding to the receptor (s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection) . Binding to the macrophage specific lectin CLEC10A also seem to enhance virus infectivity. Interaction with FOLR1/folate receptor alpha may be a cofactor for virus entry in some cell types, although results are contradictory. Members of the Tyro3 receptor tyrosine kinase family also seem to be cell entry factors in filovirus infection. Once attached, the virions are internalized through clathrin-dependent endocytosis and/or macropinocytosis. After internalization of the virus into the endosomes of the host cell, proteolysis of GP1 by two cysteine proteases, CTSB/cathepsin B and CTSL/cathepsin L presumably induces a conformational change of GP2, allowing its binding to the host entry receptor NPC1 and unmasking its fusion peptide to initiate membranes fusion.
Type
Protein
Source
Mammalian Cells
Sequence
QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
19.4 kDa
Protein Length
Recombinant
NCBI Gene Symbol
GP
Host or Source
Sudan ebolavirus
Protein Name
Envelope glycoprotein
Gene Name URL
GP

Related Products

CatalogName
OACA10481-50UGGP Antibody
OACA10481-100UGGP Antibody
OPPA00998-100UGHIV-2 gp-36 Protein
OPEF01703-1MGRecombinant Ebola Virus (Zaire-gp) Antigen
OPMA04221-1MGHuman Beta-2 gp I Protein
OPNB00011-1MGEbola Virus GP (Zaire)
OPNB00011-100UGEbola Virus GP (Zaire)
OKRC00496-96WOKRC00496-96W - GOLM1/GP-73 ELISA Kit (Human)
OPCD05911-200UGON Recombinant Protein
OPCD05912-10UGON Recombinant Protein

Alternative Products

CatalogName
NBP2-35001Recombinant Protein A Protein
PROTB3GGB2-100ugS. aureus Recombinant Protein A Recombinant Protein
96-361Glyco Recombinant Protein A33 Recombinant Protein
TP780003Enterokinase Recombinant Protein (Enterokinase) Recombinant Protein
P4242-100mgRecombinant Protein A
MBS313445-01Protein A, Recombinant
22060644-1Protein A (Recombinant)

Popular Products