SFTPC Recombinant Protein

• Gene Name :

  Surfactant protein C

• Gene Aliases :

  BRICD6; BRICHOS domain containing 6; PSP-C; pulmonary surfactant apoprotein-2 SP-C; pulmonary surfactant-associated protein C; pulmonary surfactant-associated proteolipid SPL (Val) ; SFTP2; SMDP2; SP5; SP-C.

• Gene ID :

  6440

• Accession Number :

  NP_001165828.1

• Reactivity :

  Homo sapiens|Human

• Target :

  Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

• Type :

  Protein

• Source :

  Mammalian Cells

• Sequence :

  FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid or Lyophilized powder

• Buffer :

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution :

  -20°C or -80°C

• Molecular Weight :

  7.7 kDa

• Protein Length :

  Recombinant

• NCBI Gene Symbol :

  SFTPC

• Host or Source :

  Human

• Protein Name :

  Pulmonary surfactant-associated protein C

• Gene Name URL :

  SFTPC

• CAS Number :

  9000-83-3

• Nucleotide Accession Number :

  NM_001172357.1