OmpA Recombinant Protein

• Gene Name :

  Outer membrane protein OmpA

• Gene Aliases :

  ECs_1041; Outer membrane protein II*; outer membrane protein OmpA.

• Gene ID :

  917123

• Accession Number :

  NP_309068.1

• Reactivity :

  Escherichia coli

• Target :

  Required for the action of colicins K and L and for the stabilization of mating aggregates in conjugation. Serves as a receptor for a number of T-even like phages. Also acts as a porin with low permeability that allows slow penetration of small solutes (By similarity) .

• Type :

  Protein

• Source :

  E.coli

• Sequence :

  WTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA

• Purification :

  Affinity purified using IMAC

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration :

  Varies by lot. See vial for concentration.

• Format :

  Liquid or Lyophilized powder

• Reconstitution :

  -20°C or -80°C

• Molecular Weight :

  35.6 kDa

• Protein Length :

  Recombinant

• NCBI Gene Symbol :

  OmpA

• Host or Source :

  Escherichia coli

• Protein Name :

  Outer membrane protein A

• Gene Name URL :

  OmpA

• CAS Number :

  9000-83-3

• Nucleotide Accession Number :

  NC_002695.1