OmpA Recombinant Protein

• Gene Name:

  Outer membrane protein OmpA

• Gene Aliases:

  ECs_1041; Outer membrane protein II*; outer membrane protein OmpA.

• Gene ID:

  917123

• Accession Number:

  NP_309068.1

• Reactivity:

  Escherichia coli

• Target:

  Required for the action of colicins K and L and for the stabilization of mating aggregates in conjugation. Serves as a receptor for a number of T-even like phages. Also acts as a porin with low permeability that allows slow penetration of small solutes (By similarity) .

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  WTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA

• Purification:

  Affinity purified using IMAC

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  Varies by lot. See vial for concentration.

• Format:

  Liquid or Lyophilized powder

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  35.6 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  OmpA

• Host or Source:

  Escherichia coli

• Protein Name:

  Outer membrane protein A

• Gene Name URL:

  OmpA

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NC_002695.1