TMPRSS2 Recombinant Protein

CAT:
247-OPCA03288-20UG
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
TMPRSS2 Recombinant Protein - image 1

TMPRSS2 Recombinant Protein

  • Gene Name :

    Transmembrane serine protease 2
  • Gene Aliases :

    Epitheliasin; PRSS10; serine protease 10; transmembrane protease serine 2; transmembrane protease, serine 2.
  • Gene ID :

    7113
  • Accession Number :

    NP_001128571.1
  • Reactivity :

    Homo sapiens|Human
  • Target :

    Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus-cell membrane fusions; spike proteins are synthesized and maintained in precursor intermediate folding states and proteolysis permits the refolding and energy release required to create stable virus-cell linkages and membrane coalescence. Facilitates human SARS coronavirus (SARS-CoV) infection via two independent mechanisms, proteolytic cleavage of ACE2, which might promote viral uptake, and cleavage of coronavirus spike glycoprotein which activates the glycoprotein for cathepsin L-independent host cell entry. Proteolytically cleaves and activates the spike glycoproteins of human coronavirus 229E (HCoV-229E) and human coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0 of Sendai virus (SeV), human metapneumovirus (HMPV), human parainfluenza 1, 2, 3, 4a and 4b viruses (HPIV) . Essential for spread and pathogenesis of influenza A virus (strains H1N1, H3N2 and H7N9) ; involved in proteolytic cleavage and activation of hemagglutinin (HA) protein which is essential for viral infectivity.
  • Type :

    Protein
  • Source :

    Yeast
  • Sequence :

    WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
  • Purification :

    Affinity purified using IMAC
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid or Lyophilized powder
  • Reconstitution :

    -20°C or -80°C
  • Molecular Weight :

    44.8 kDa
  • Protein Length :

    Recombinant
  • NCBI Gene Symbol :

    TMPRSS2
  • Host or Source :

    Yeast
  • Protein Name :

    Transmembrane protease serine 2
  • Gene Name URL :

    TMPRSS2
  • CAS Number :

    9000-83-3
  • Nucleotide Accession Number :

    NM_001135099.1

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide