PPAN Recombinant Protein

• Gene Name:

  Peter pan homolog|PPAN-P2RY11 readthrough

• Gene Aliases:

  Brix domain-containing protein 3; BXDC3; homolog of S. cerevisiae SSF1; P2RY11; P2Y purinoceptor 11; P2Y11; Peter Pan homolog; PPAN; PPAN-P2RY11 protein; PPAN-P2RY11 readthrough transcript; second-step splicing factor 1; SSF; SSF1; SSF-1; SSF1/P2Y11 protein; SSF2; suppressor of sterile four 1; suppressor of SWI4 1 homolog.

• Gene ID:

  56342|692312

• Accession Number:

  NP_001035754.1

• Reactivity:

  Homo sapiens|Human

• Target:

  May have a role in cell growth.

• Type:

  Protein

• Source:

  Yeast

• Sequence:

  MGQSGRSRHQKRARAQAQLRNLEAYAANPHSFVFTRGCTGRNIRQLSLDVRRVMEPLTASRLQVRKKNSLKDCVAVAGPLGVTHFLILSKTETNVYFKLMRLPGGPTLTFQVKKYSLVRDVVSSLRRHRMHEQQFAHPPLLVLNSFGPHGMHVKLMATMFQNLFPSINVHKVNLNTIKRCLLIDYNPDSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSESEAEPDGDHNITELPQAVAGRGNMRAQQSAVRLTEIGPRMTLQLIKVQEGVGEGKVMFHSFVSKTEEELQAILEAKEKKLRLKAQRQAQQAQNVQRKQEQREAHRKKSLEGMKKARVGGSDEEASGIPSRTASLELGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRKRWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGGRGRGRGRPGKRVA

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  55.2 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  PPAN|PPAN-P2RY11

• Host or Source:

  Human

• Protein Name:

  Suppressor of SWI4 1 homolog

• Gene Name URL:

  PPAN|PPAN-P2RY11

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001040664.2