Products for Research Use Only
RegisterLogin

IFNT1 Recombinant Protein

CAT: 0247-OPCA02877-100UGSize: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA02877-100UGSize:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Name
Interferon tau
Gene Aliases
Antiluteolysin; IFNT; IFNT1; IFN-tau1; IFN-tau-1; IFN-tau2; IFN-tau-2; IFN-tau-c2; interferon alpha II; interferon tau-1; interferon tau-2; interferon, trophoblast; interferon-tau1e; interferon-tau3e; TP-1; trophoblast antiluteolytic protein; Trophoblast protein 1; trophoblast protein-1; trophoblast type I interferon; trophoblastin.
Gene ID
317698
Reactivity
Bos taurus|Bovine
Target
Paracrine hormone primarily responsible for maternal recognition of pregnancy. Interacts with endometrial receptors, probably type I interferon receptors, and blocks estrogen receptor expression, preventing the estrogen-induced increase in oxytocin receptor expression in the endometrium. This results in the suppression of the pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha, hindering the regression of the corpus luteum (luteolysis) and therefore a return to ovarian cyclicity. This, and a possible direct effect of IFN-tau on prostaglandin synthesis, leads in turn to continued ovarian progesterone secretion, which stimulates the secretion by the endometrium of the nutrients required for the growth of the conceptus. In summary, displays particularly high antiviral and antiproliferative potency concurrently with particular weak cytotoxicity, high antiluteolytic activity and immunomodulatory properties. In contrast with other IFNs, IFN-tau is not virally inducible.
Type
Protein
Source
Yeast
Sequence
CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
21.8 kDa
Protein Length
Recombinant
NCBI Gene Symbol
IFNT2
Host or Source
Bovine
Protein Name
Interferon tau-1
Gene Name URL
IFNT2

Related Products

CatalogName
OPCD04144-10UGIFNB1 Recombinant Protein
OPCD08011-10UGIFNA1 Recombinant Protein
OPCD04118-50UGIFNA1 Recombinant Protein
OPCD04111-10UGIFNA1 Recombinant Protein
OPCD04145-10UGIFNB1 Recombinant Protein
OPCD08010-50UGIFNA1 Recombinant Protein
OPCD04111-200UGIFNA1 Recombinant Protein
OPCD08010-10UGIFNA1 Recombinant Protein
OPCD04399-200UGIFNL1 Recombinant Protein
OPCD04141-10UGIFNB1 Recombinant Protein

Alternative Products

CatalogName
TMPH-00279-01Interferon tau-1/IFNT1 Protein, Bovine, Recombinant (His)
TMPH-00278-01Interferon tau-1/IFNT1 Protein, Bovine, Recombinant (E. coli, His)
GTR18880881-01Bovine IFNT1 protein
GTR18881894-01Yeast IFNT1 protein
RPC25116-01Recombinant Bovine Interferon tau-1 (IFNT1)
AP71014-01Recombinant Bovine Interferon tau-1(IFNT1)
GTR19033314-01Recombinant Sheep Interferon tau-1 (IFNT1)
AP9C701-01Recombinant Sheep Interferon Tau-1 (IFNT1), C-His
AP9C261-01Recombinant Bovine Interferon Tau-1 (IFNT1), N-His
373764-01IFNT1, Recombinant, Bovine, aa24-195, His-Tag (Interferon Tau-1)

Popular Products