FCGRT Recombinant Protein

• Gene Name:

  Fc fragment of IgG receptor and transporter

• Gene Aliases:

  Alpha-chain; Fc fragment of IgG, receptor, transporter, alpha; FCRN; FcRn alpha chain; heavy chain of the major histocompatibility complex class I-like Fc receptor; IgG Fc fragment receptor transporter alpha chain; IgG receptor FcRn large subunit p51; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; neonatal Fc receptor; neonatal Fc-receptor for Ig; transmembrane alpha chain of the neonatal receptor.

• Gene ID:

  2217

• Accession Number:

  NP_001129491.1

• Reactivity:

  Homo sapiens|Human

• Target:

  Binds to the Fc region of monomeric immunoglobulins gamma (PubMed:7964511, PubMed:10933786) . Mediates the selective uptake of IgG from milk and helps newborn animals to acquire passive immunity. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids (By similarity) . Possible role in transfer of immunoglobulin G from mother to fetus (PubMed:7964511) .

• Type:

  Protein

• Source:

  Yeast

• Sequence:

  AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  32.4 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  FCGRT

• Host or Source:

  Human

• Protein Name:

  IgG receptor FcRn large subunit p51

• Gene Name URL:

  FCGRT

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001136019.2