IL36RN Recombinant Protein

• Gene Name:

  Interleukin 36 receptor antagonist

• Gene Aliases:

  FIL1; FIL1 delta; FIL1 (DELTA) ; FIL1D; IL-1 related protein 3; IL1F5; IL1F5 (Canonical product IL-1F5a) ; IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta) ; IL1HY1; IL1L1; IL-1ra homolog 1; IL-1-related protein 3; IL1RP3; IL-36Ra; IL36RA; interleukin 1 family, member 5 (delta) ; Interleukin-1 delta; Interleukin-1 family member 5; interleukin-1 HY1; interleukin-1 receptor antagonist homolog 1; interleukin-1-like protein 1; interleukin-36 receptor antagonist protein; PSORP; PSORS14.

• Gene ID:

  26525

• Accession Number:

  NP_036407.1

• Reactivity:

  Homo sapiens|Human

• Target:

  Inhibits the activity of interleukin-36 (IL36A, IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  33 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  IL36RN

• Host or Source:

  Human

• Protein Name:

  Interleukin-36 receptor antagonist protein

• Gene Name URL:

  IL36RN

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_012275.2