DYNLRB1 Recombinant Protein

• Gene Name:

  Dynein light chain roadblock-type 1

• Gene Aliases:

  BITH; bithoraxoid-like protein; BLP; DNCL2A; DNLC2A; Dynein light chain 2A, cytoplasmic; dynein light chain roadblock-type 1; dynein, cytoplasmic, light polypeptide 2A; dynein-associated protein Km23; roadblock domain-containing protein 1; ROBL/LC7-like 1; ROBLD1.

• Gene ID:

  83658

• Accession Number:

  NP_001268656.1

• Reactivity:

  Homo sapiens|Human

• Target:

  Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  26.7 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  DYNLRB1

• Host or Source:

  Human

• Protein Name:

  Dynein light chain roadblock-type 1

• Gene Name URL:

  DYNLRB1

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001281727.1