KIR2DS1 Recombinant Protein

• Gene Name:

  Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1

• Gene Aliases:

  CD158 antigen-like family member H; CD158a; CD158H; killer cell immunoglobulin-like receptor 2DS1; killer cell immunoglobulin-like receptor KIRDS1; killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1; killer-cell immunoglobulin-like receptor; KIR2DS1 Killer-cell Immunoglobulin-like Receptor; MHC class I NK cell receptor Eb6 ActI; p50.1.

• Gene ID:

  3806

• Accession Number:

  NP_055327.1

• Reactivity:

  Homo sapiens|Human

• Target:

  Receptor on natural killer (NK) cells for some HLA-C alleles such as w6. Does not inhibit the activity of NK cells.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  28.8 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  KIR2DS1

• Host or Source:

  Human

• Protein Name:

  Killer cell immunoglobulin-like receptor 2DS1

• Gene Name URL:

  KIR2DS1

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_014512.1