Products for Research Use Only
RegisterLogin

Beta-mammal toxin Css4 Recombinant Protein

CAT: 0247-OPCA02093-1MGSize: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA02093-1MGSize:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Aliases
Css IV.
Reactivity
Centruroides suffusus
Target
Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.
Type
Protein
Source
E.coli
Sequence
KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
23.6 kDa
Protein Length
Recombinant
Host or Source
Centruroides suffusus suffusus
Protein Name
Beta-mammal toxin Css4

Related Products

CatalogName
OPCA02101-100UGBeta-mammal toxin Cn2 Recombinant Protein
OPCA02922-20UGBeta-mammal toxin Cn2 Recombinant Protein
OPCA02101-20UGBeta-mammal toxin Cn2 Recombinant Protein
OPCA02922-1MGBeta-mammal toxin Cn2 Recombinant Protein
OPCA02922-100UGBeta-mammal toxin Cn2 Recombinant Protein
OPCA02101-1MGBeta-mammal toxin Cn2 Recombinant Protein
OPCA02955-20UGToxin zeta Recombinant Protein
OPCA03204-1MGToxin MIT1 Recombinant Protein
OPCA03204-20UGToxin MIT1 Recombinant Protein
OPCA03204-100UGToxin MIT1 Recombinant Protein

Alternative Products

CatalogName
CSB-EP350214DRC-01Recombinant Centruroides suffusus Beta-mammal toxin Css4
GTR19022669-01Recombinant Centruroides suffusus suffusus Beta-mammal toxin Css4
TMPH-00362-01Beta-mammal toxin Css4 Protein, Centruroides suffusus, Recombinant (His & SUMO)
GTR18882388-01Insect Mexican scorpion Beta-mammal toxin Css4 protein
MBS1045370-01Recombinant Centruroides suffusus suffusus (Mexican scorpion) Beta-mammal toxin Css4
583791-01Beta-mammal Toxin Css4, Recombinant, Centruroides suffusus, aa20-85, His-Tag
370542-01Beta-mammal Toxin Css4, Recombinant, Centruroides Suffusus Suffusu, aa20-85, His-SUMO-Tag
92-498Toxin B Recombinant Protein
PR01162Recombinant Vibriocholerae Toxin B Protein
TMPJ-00744-01Toxin B Protein, Vibriocholerae, Recombinant

Popular Products