Products for Research Use Only
RegisterLogin

VP4 Recombinant Protein

CAT: 0247-OPCA02004-100UGSize: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA02004-100UGSize:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Aliases
Hemagglutinin.
Reactivity
Human Rotavirus A|Rotavirus A
Target
Outer capsid protein VP4: Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. It is subsequently lost, together with VP7, following virus entry into the host cell. Following entry into the host cell, low intracellular or intravesicular Ca (2+) concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7. During the virus exit from the host cell, VP4 seems to be required to target the newly formed virions to the host cell lipid rafts.
Type
Protein
Source
E.coli
Sequence
AQVSEDIIISKTSLWKEMQYNRDIIIRFKFNNSIIKLGGLGYKWSEISFKAANYQYNYLRDGEQVTAHTTCSVNGVNNFSYNGGLLPTHFSISRYEVIKENSYVYVDYWDDSQAFRNMVYVRSLAANLNSVKCSGGNYNFQMPVGAWPVMSGGAVSLHFAGVTLSTQFTDFVSLNSLRFRFSLTVEEPPFSILRTRVSGLYGLPASNPNSGHEYYEIAGRFSLISLVPSNDDY
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
42.3 kDa
Protein Length
Recombinant
Host or Source
Rotavirus A
Protein Name
Outer capsid protein VP4

Related Products

CatalogName
OPPA00870-100UGHAV VP4-VP2 Protein
OPCA02275-100UGVP40 Recombinant Protein
OPCA02327-100UGVP40 Recombinant Protein
OPCA02327-20UGVP40 Recombinant Protein
OPCA02275-20UGVP40 Recombinant Protein
OPCA02327-1MGVP40 Recombinant Protein
OPCA02275-1MGVP40 Recombinant Protein
OPCA04670-100UGVP40 Recombinant Protein (Reston Ebola virus)
OPCA04670-20UGVP40 Recombinant Protein (Reston Ebola virus)
OPCA04670-1MGVP40 Recombinant Protein (Reston Ebola virus)

Alternative Products

CatalogName
NBP2-34964-100mgRecombinant Protein A Protein
PROTB3GGB2-100ugS. aureus Recombinant Protein A Recombinant Protein
96-361Glyco Recombinant Protein A33 Recombinant Protein
TP780003Enterokinase Recombinant Protein (Enterokinase) Recombinant Protein
TMPY-00125Recombinant Protein A
22060644-1Protein A (Recombinant)

Popular Products